- Recombinant Saccharomyces cerevisiae Uncharacterized protein YER039C-A (YER039C-A)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1099204
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,986 Da
- E Coli or Yeast
- 26299
- Uncharacterized protein YER039C-A (YER039C-A)
Sequence
MSKHKHEWTESVANSGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANF